DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and lectin-46Ca

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:154 Identity:36/154 - (23%)
Similarity:72/154 - (46%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LLTHGTAMGRKLEENE---------IFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQ 147
            |:|..:..|:|..:.|         ..::|..|.:|: ..:|:||..|.:.|.:.|.:||.:.:.
  Fly    11 LMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYV-GIKKINWFGAQNNCLRKGLNLADVSTM 74

  Fly   148 EELDRFNNQLN---GLNRYWIDVTNQFNESEFVSVTKGSKANFLSWAD-GEPTKDG---ECVDIR 205
            |:.....:.:.   |.:.:|....:..:|..|..::.|....::..:: .|||:..   :|::||
  Fly    75 EDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIR 139

  Fly   206 TFNGKTTMNDNSCFANLYFICEKS 229
            .....|.:.|.:|....|||||::
  Fly   140 IRPNVTVVLDVNCQEKKYFICEQN 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/118 (24%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.