DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and lectin-46Cb

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001163102.1 Gene:lectin-46Cb / 53522 FlyBaseID:FBgn0040092 Length:322 Species:Drosophila melanogaster


Alignment Length:146 Identity:39/146 - (26%)
Similarity:66/146 - (45%) Gaps:15/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 QLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNN 155
            :||..|....|:     ..:::..|.||. ..:|:||..||:.|.:.|..||.|.:|.:.|....
  Fly    19 ELLGSGPPCPRR-----YLRRINGKCYYF-SVKKMNWFGALNNCLRKGLTLADLSNQRDFDGAIG 77

  Fly   156 QLNGLNR---YWIDVTNQFNESEFVSVTKGSKANFLS-WADGEPTKDGECVDIRTFNGKTTMN-- 214
            .|:||..   :|....:.::|..|..::.|....:.| :::..|.:..||.|......::.:|  
  Fly    78 FLSGLGNTEDFWFGGNDLYHEGRFQYISNGRLVRYYSNYSNVLPLEHSECDDCLEVRIRSEINMV 142

  Fly   215 --DNSCFANLYFICEK 228
              || |....||||.:
  Fly   143 SADN-CHERQYFICSE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/119 (29%)
lectin-46CbNP_001163102.1 CLECT 38..155 CDD:153057 33/118 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.