DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and PKD1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_024306066.1 Gene:PKD1 / 5310 HGNCID:9008 Length:4343 Species:Homo sapiens


Alignment Length:198 Identity:47/198 - (23%)
Similarity:77/198 - (38%) Gaps:39/198 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RVEACEAAVAIA--RIALNDRRLDNFGTSTNLQLENQNTS-----QQLLTHGTAMGRKL-----E 104
            :|||..||:.:.  ....:|..||       |.::|:..|     ..::..|....|.:     .
Human   351 QVEAAPAALELVCPSSVQSDESLD-------LSIQNRGGSGLEAAYSIVALGEEPARAVHPLCPS 408

  Fly   105 ENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTN 169
            :.|||.  |:.:.|....||..|..|.::|....|...::.....:.||  .::.:.|. :||..
Human   409 DTEIFP--GNGHCYRLVVEKAAWLQAQEQCQAWAGAALAMVDSPAVQRF--LVSRVTRS-LDVWI 468

  Fly   170 QFNESEFVSVTKGSKANFLS------WADGEP---TKDGECVDIRTFNGKT-TMNDNSCFANLYF 224
            .|:..:.|.|....:....|      |..|||   |.: .||.:    |.| ..|.:.|.|...:
Human   469 GFSTVQGVEVGPAPQGEAFSLESCQNWLPGEPHPATAE-HCVRL----GPTGWCNTDLCSAPHSY 528

  Fly   225 ICE 227
            :||
Human   529 VCE 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/122 (25%)
PKD1XP_024306066.1 LRR <50..>126 CDD:227223
leucine-rich repeat 70..92 CDD:275378
leucine-rich repeat 93..116 CDD:275378
PCC 97..2768 CDD:188093 47/198 (24%)
leucine-rich repeat 117..129 CDD:275378
GPS 3051..3100 CDD:197639
PLAT_polycystin 3158..3277 CDD:238850
PKD_channel 3751..4153 CDD:332708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.