Sequence 1: | NP_001356891.1 | Gene: | CG7763 / 36235 | FlyBaseID: | FBgn0040503 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024306066.1 | Gene: | PKD1 / 5310 | HGNCID: | 9008 | Length: | 4343 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 47/198 - (23%) |
---|---|---|---|
Similarity: | 77/198 - (38%) | Gaps: | 39/198 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 RVEACEAAVAIA--RIALNDRRLDNFGTSTNLQLENQNTS-----QQLLTHGTAMGRKL-----E 104
Fly 105 ENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTN 169
Fly 170 QFNESEFVSVTKGSKANFLS------WADGEP---TKDGECVDIRTFNGKT-TMNDNSCFANLYF 224
Fly 225 ICE 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7763 | NP_001356891.1 | CLECT | 116..228 | CDD:153057 | 30/122 (25%) |
PKD1 | XP_024306066.1 | LRR | <50..>126 | CDD:227223 | |
leucine-rich repeat | 70..92 | CDD:275378 | |||
leucine-rich repeat | 93..116 | CDD:275378 | |||
PCC | 97..2768 | CDD:188093 | 47/198 (24%) | ||
leucine-rich repeat | 117..129 | CDD:275378 | |||
GPS | 3051..3100 | CDD:197639 | |||
PLAT_polycystin | 3158..3277 | CDD:238850 | |||
PKD_channel | 3751..4153 | CDD:332708 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |