DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CD207

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:171 Identity:44/171 - (25%)
Similarity:67/171 - (39%) Gaps:23/171 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ALNDRRLDNFGTSTNLQ--LENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWH 128
            |||.:.....|:..|:.  |:.||...|:::.|            ::.....:||.....| .|:
Human   166 ALNTKIRALQGSLENMSKLLKRQNDILQVVSQG------------WKYFKGNFYYFSLIPK-TWY 217

  Fly   129 DALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESE--FVSVTKGSKANFLS-W 190
            .|...|.....||.|:.|:.|.:.......|| .|||.:|....|.:  :|..|..:|...:. |
Human   218 SAEQFCVSRNSHLTSVTSESEQEFLYKTAGGL-IYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFW 281

  Fly   191 ADGEPTKDG---ECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            ..|||...|   .|.:|:. ......||..|.....|||::
Human   282 IPGEPNNAGNNEHCGNIKA-PSLQAWNDAPCDKTFLFICKR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/117 (29%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 35/139 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.