DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec7a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001166857.1 Gene:Clec7a / 502902 RGDID:1565140 Length:235 Species:Rattus norvegicus


Alignment Length:210 Identity:42/210 - (20%)
Similarity:77/210 - (36%) Gaps:54/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CEAAVAIARI--ALNDRRL---------DNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIF 109
            |...|.:|.:  ||..||.         |||.:...   ||...::..|....|..:..:...:|
  Rat    45 CLLTVVVAAVLGALAFRRFNSGRYPEEKDNFPSRNK---ENHKPTEPSLDEKVAPSKASQTTGVF 106

  Fly   110 QQ-------LGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNG--LNRYWI 165
            ..       :.:|..|:....:.:|:.:...|.::|.||..:.:.:|.:...:|.:.  :|.:||
  Rat   107 SGPCLPNWIMHAKSCYLFSFSENSWYGSRRHCSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWI 171

  Fly   166 DVTNQFNESEFVSVTKGSKANFLSWADG---------------EPTKDGECVDIRTFNGKTTMND 215
            .::...:|..:.            |.||               :.:....||.|   :|....| 
  Rat   172 GLSRNQSEGPWF------------WEDGSAFTPNSFQVRNTAPQESLPHNCVWI---HGSEVYN- 220

  Fly   216 NSCFANLYFICEKSI 230
            ..|.|:.:.||||.:
  Rat   221 QMCIASSFTICEKEL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 24/128 (19%)
Clec7aNP_001166857.1 Ly49 34..>61 CDD:400616 5/15 (33%)
CLECT_NK_receptors_like 110..233 CDD:153063 25/138 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.