DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Cd207

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_578352.4 Gene:Cd207 / 502852 RGDID:1565913 Length:332 Species:Rattus norvegicus


Alignment Length:212 Identity:55/212 - (25%)
Similarity:91/212 - (42%) Gaps:35/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SMGNLQRRVEACEAAVAIAR-----IALNDRRLDNFGTS-TNLQLENQ-----NTSQQLLTHGTA 98
            |:|.::.::.:.||::.|..     :.:|...:||.... ..||.:..     ||..|.|.:...
  Rat   119 SLGRVRSKILSLEASMKIVSNQLQVLTMNWGEVDNLNAKIPELQKDLDKASALNTKVQGLQNSLE 183

  Fly    99 MGRKL--EENEIFQQL--GSKY-----YYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFN 154
            ...||  |:::|.:.:  |.||     ||..:..| .|:.|...|.....||.|:.|:.|.:...
  Rat   184 NINKLLKEQSDILEMMSRGWKYFMGNFYYFSRTPK-TWYSAEQYCISRKAHLTSVSSESEHEFLY 247

  Fly   155 NQLNGLNRYWIDVTNQFNESEF-----VSVTKGSKANFLSWADGEPT---KDGECVDIRTFNGKT 211
            ...:|: .:||.:|...:|.::     .|..|.....|  |..|||.   .:..|.:||. :...
  Rat   248 KVADGI-PHWIGLTKAGSEGDWYWVDQTSFNKEQSRRF--WIPGEPNNVRNNEHCANIRV-SALK 308

  Fly   212 TMNDNSCFANLY-FICE 227
            ..||:.| .|:| |||:
  Rat   309 CWNDSPC-DNVYSFICK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 35/126 (28%)
Cd207XP_578352.4 DUF881 127..>190 CDD:303034 14/62 (23%)
CLECT_DC-SIGN_like 202..325 CDD:153060 37/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.