DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC497796

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001104780.1 Gene:LOC497796 / 497796 RGDID:2291887 Length:268 Species:Rattus norvegicus


Alignment Length:207 Identity:43/207 - (20%)
Similarity:79/207 - (38%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNL-QLENQNTSQQLLTHGTAMGRK 102
            :|.|.....|:..:.|      .:..:::|..:.::...|.|. |.:..:.::.:|......|:.
  Rat    86 INNCSTMQSNIDLKEE------MLRNMSINCSQGNDLLQSLNREQTKWYSETKTVLPSSQHTGKN 144

  Fly   103 LEENEIFQ-QLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWID 166
            :   ||:. ..|.|.||...:.|. |:.....|......|..:..::||.....|.... :|||.
  Rat   145 V---EIYWFCYGIKCYYFILDTKA-WNGCKQTCQDSSLFLLKIDDEDELKFLRLQFLSY-QYWIG 204

  Fly   167 VTNQFNESEFVSVTKGSKANFLSWADGEPT-----------KDGECVDIRTFNGKTTMNDNSCFA 220
            ::....|.|:            ||.|...:           |||:|:    |..|..:.:..| :
  Rat   205 LSYNKTEKEW------------SWIDNGQSELSLNLKKYNVKDGDCM----FLSKARLENAMC-S 252

  Fly   221 NLY-FICEKSIE 231
            |.| .||:|.::
  Rat   253 NPYPCICQKRLD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/123 (23%)
LOC497796NP_001104780.1 Ly49 40..159 CDD:285577 15/81 (19%)
CLECT_NK_receptors_like 146..261 CDD:153063 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.