DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and colec10

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 / 496663 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis


Alignment Length:134 Identity:43/134 - (32%)
Similarity:65/134 - (48%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KLEENEI--FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLN--GLNR 162
            |..:|.|  .::...|||||.:||: |:.|||.:|...||.||..:.|.......:.::  ||.|
 Frog   141 KFVKNVIAGIRETDEKYYYIVREER-NYRDALTQCRIRGGTLAMPKDQATNSLIADYISKMGLFR 204

  Fly   163 YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG----ECVDIRTFNGKTTMNDNSCFANLY 223
            .:|.:.:...|.:||.........:.||..||| .||    :||::.:..   ..||..|...:|
 Frog   205 VFIGINDIEKEKQFVYADNSPLQTYSSWKAGEP-NDGSGYEDCVEMLSTG---HWNDVDCSLTIY 265

  Fly   224 FICE 227
            |:||
 Frog   266 FVCE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 39/118 (33%)
colec10NP_001011227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..76
CLECT_collectin_like 155..270 CDD:153061 40/120 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.