DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec10a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_012815686.1 Gene:clec10a / 496661 XenbaseID:XB-GENE-947983 Length:338 Species:Xenopus tropicalis


Alignment Length:234 Identity:50/234 - (21%)
Similarity:82/234 - (35%) Gaps:78/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQ-NTSQQLLTHGT--------- 97
            :.::|.|..||:.         :.:||.||....|    :||.. ...|..||.||         
 Frog   137 LGTLGRLVDRVQT---------LQVNDTRLMEKLT----ELEGSVKKFQGTLTIGTLQSDMQKVL 188

  Fly    98 -AMGRKLEENEIFQQLGSK--------------YYYIEKEEKLNWHDALDKCHKMGGHLASLQSQ 147
             .:.:.::..:..|..||:              .||:.| ....|.:|..:|..:..||..:.::
 Frog   189 GTLSKLVDRVQNLQVNGSQEPLCPDNWHRFTLSCYYVSK-SGYPWEEAKKRCEGLSAHLVVINNE 252

  Fly   148 EELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG------------- 199
            :|.:.......| ...||.:|:  :|.|:            .|.||.|....             
 Frog   253 DEQEYVFGIAKG-QFTWIGLTD--SEGEW------------KWLDGTPYNTSPKFWIADQPDNYF 302

  Fly   200 --------ECVDIRTFNGKTTMNDNSCFANLYFICEKSI 230
                    :|..:. :||:  .||:.|.....|||||:|
 Frog   303 GHGLGGGEDCAHLH-YNGQ--WNDDHCSRRYRFICEKAI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/132 (21%)
clec10aXP_012815686.1 Lectin_N <79..>124 CDD:281887
PTRF_SDPR 136..>204 CDD:291890 17/79 (22%)
CLECT_DC-SIGN_like 211..336 CDD:153060 28/143 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11019
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.