DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Ly49i4

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001009495.1 Gene:Ly49i4 / 494204 RGDID:1549758 Length:280 Species:Rattus norvegicus


Alignment Length:130 Identity:27/130 - (20%)
Similarity:46/130 - (35%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFV 177
            |.|.||...:.:: ||:....|.........:..::||....:.:...| |||..:....:.|: 
  Rat   152 GIKCYYFTMDIRI-WHECKQTCQNYSLSFLKIDDKDELKFLQDHIIRDN-YWIGSSYNNKKKEW- 213

  Fly   178 SVTKGSKANFLSWADGEP-----------TKDGECVDIRTFNGKTTMNDNSCFANLYFICEKSIE 231
                       ||.|..|           .|.|.|:    :.....::|:.|......||||.::
  Rat   214 -----------SWIDNSPFNLDFVARNSLRKTGYCM----YFSMAGLHDDDCGKRYLCICEKGMD 263

  Fly   232  231
              Rat   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 23/122 (19%)
Ly49i4NP_001009495.1 Ly49 40..158 CDD:285577 3/5 (60%)
CLECT_NK_receptors_like 145..260 CDD:153063 25/125 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.