DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec4a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001005899.2 Gene:Clec4a / 474143 RGDID:1359662 Length:240 Species:Rattus norvegicus


Alignment Length:132 Identity:40/132 - (30%)
Similarity:62/132 - (46%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FQQLGSKYYYIEKE----EKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTN 169
            ::..||..|::.|.    .|.:|:::...|..||.||..:.|:||.|.....||....|:|.:.:
  Rat   111 WKPFGSHCYWVTKHTSTYSKASWNESEKNCFSMGAHLLVIHSKEEQDFITGILNRDAAYFIGLWD 175

  Fly   170 Q-FNESEFVSVTK-GSKANFLSWADGEPTKDGE-CVDIRTFNGKTTMNDNSCFANLYFICE-KSI 230
            . ..:.::||.|. .:.|.|  |..|||:.|.| ||.|...|.....||..|......:|: |.|
  Rat   176 SGHRQWQWVSQTPYNASATF--WHKGEPSSDDEKCVIINHLNSGWGWNDIPCSGKQQSVCQMKKI 238

  Fly   231 EI 232
            ::
  Rat   239 QL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/119 (30%)
Clec4aNP_001005899.2 ITIM motif 5..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..38
CLECT_DC-SIGN_like 107..235 CDD:153060 38/125 (30%)
Mannose binding. /evidence=ECO:0000250|UniProtKB:Q9UMR7 200..202 1/1 (100%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000250|UniProtKB:Q9UMR7 211..213 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11467
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5325
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.