DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and MRC1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_002429.1 Gene:MRC1 / 4360 HGNCID:7228 Length:1456 Species:Homo sapiens


Alignment Length:234 Identity:59/234 - (25%)
Similarity:101/234 - (43%) Gaps:43/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSSSYSAACEGVE-SDSQCAAY---CYGVLNPCIASMGNLQRRVEACEAAVAIARIALND---RR 71
            |..:|.:..||.. ||....:|   .||..|       |.| .||.|........::.||   ..
Human   715 LGLTYGSPSEGFTWSDGSPVSYENWAYGEPN-------NYQ-NVEYCGELKGDPTMSWNDINCEH 771

  Fly    72 LDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHK 136
            |:|:    ..|::...|.:...|........:.|:........:||:.:::|.::  :|...|.:
Human   772 LNNW----ICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMD--NARAFCKR 830

  Fly   137 MGGHLASLQSQEE---LDRFNNQLNGLNRYWIDVTNQFNESEFVSVTK------GSKANFLSWAD 192
            ..|.|.|:||:.|   |.::.|:.:..:.|:|.:        .:|:.|      |||.:::|||.
Human   831 NFGDLVSIQSESEKKFLWKYVNRNDAQSAYFIGL--------LISLDKKFAWMDGSKVDYVSWAT 887

  Fly   193 GEP---TKDGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            |||   .:|..||.:.:.:|  ..||.:|.....|||::
Human   888 GEPNFANEDENCVTMYSNSG--FWNDINCGYPNAFICQR 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/123 (29%)
MRC1NP_002429.1 RICIN 27..142 CDD:214672
RICIN 34..141 CDD:238092
FN2 161..209 CDD:128373
CLECT 234..342 CDD:153057
CLECT 362..487 CDD:214480
CLECT 504..626 CDD:214480
CLECT 659..779 CDD:153057 19/75 (25%)
CLECT 802..923 CDD:214480 35/132 (27%)
CLECT 945..1080 CDD:214480
CLECT 1097..1213 CDD:214480
CLECT 1230..1356 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.