DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and ASGR2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_011522164.2 Gene:ASGR2 / 433 HGNCID:743 Length:410 Species:Homo sapiens


Alignment Length:282 Identity:55/282 - (19%)
Similarity:98/282 - (34%) Gaps:99/282 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLVLPLCLSSSYSAACEGVESDSQCAAYCYGVLNPCIASMGNLQRRVEACEAAVAIARIALNDR 70
            |.|::.:|::.|.|....|.:..::.|               .||..:.:.:.|           
Human   160 ILLLVVICVTGSQSEGHGGQQGWARGA---------------QLQAELRSLKEA----------- 198

  Fly    71 RLDNFGTSTNLQLENQNTSQQLLTHG-------TAMGRKLEENE----------IF--------- 109
             ..||.:||..::      |.:.|||       |::|.|||:.:          :|         
Human   199 -FSNFSSSTLTEV------QAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDL 256

  Fly   110 -------------------------QQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEE 149
                                     :..||.|::....:.  |.:|...|.....||..:.|.||
Human   257 RFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKA--WAEAEKYCQLENAHLVVINSWEE 319

  Fly   150 LDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTK--------DGECVDIRT 206
            ........|..|. ||.:|:.....::|..| ..:.|:.:||..:|..        ..:||:::.
Human   320 QKFIVQHTNPFNT-WIGLTDSDGSWKWVDGT-DYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQP 382

  Fly   207 FNGKTTMNDNSCFANLYFICEK 228
             :|:  .||:.|.....::|||
Human   383 -DGR--WNDDFCLQVYRWVCEK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/119 (23%)
ASGR2XP_011522164.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.