DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and ASGR1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:215 Identity:43/215 - (20%)
Similarity:73/215 - (33%) Gaps:68/215 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NFGTSTNLQLENQNTSQQLLTHGTAMGRKLE--ENEIFQQL------------------------ 112
            ||..||..|::.      |.|.|..:|||::  |:::.:|.                        
Human    79 NFTASTEAQVKG------LSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSL 137

  Fly   113 ----------GSK--------------YYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRF 153
                      ||:              .|:..:..|. |.||.:.|.....||..:.|.||....
Human   138 SCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKA-WADADNYCRLEDAHLVVVTSWEEQKFV 201

  Fly   154 NNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTK-------DGECVDIRTFNGKT 211
            .:.:..:|. |:.:.:|....::|..| ..:..|.:|...:|..       .||  |...|....
Human   202 QHHIGPVNT-WMGLHDQNGPWKWVDGT-DYETGFKNWRPEQPDDWYGHGLGGGE--DCAHFTDDG 262

  Fly   212 TMNDNSCFANLYFICEKSIE 231
            ..||:.|.....::||..::
Human   263 RWNDDVCQRPYRWVCETELD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/118 (23%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 17..144 CDD:309178 13/70 (19%)
CLECT_DC-SIGN_like 154..279 CDD:153060 27/129 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.