DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CG14866

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001138057.1 Gene:CG14866 / 41854 FlyBaseID:FBgn0038315 Length:455 Species:Drosophila melanogaster


Alignment Length:184 Identity:41/184 - (22%)
Similarity:66/184 - (35%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQQLLTHGTAMGRKLEENE----IFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASL----Q 145
            |:||:.:..|...:.|..:    .|.::....|||..::::||..|...|..:..|||..    :
  Fly   251 SEQLIYYLMAGNNQKEVKDPCPANFTRISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSE 315

  Fly   146 SQEELDRFNNQ---------LNGLN--RYWI------DVTNQFNESEFVSVTKGSKANFLSWAD- 192
            ::|.:....||         |.|||  ..||      .|....|.:......||..:...:..| 
  Fly   316 NEEIMAYLLNQPTHRGRDYWLGGLNPGLLWIWSNSAKPVNPNMNLTSIAMAQKGENSTAANLVDS 380

  Fly   193 ---------GEPTKD--------GECVDIRTFNGKTT--MNDNSCFANLYFICE 227
                     ||...:        |.|:.:....||.:  .....|.:..|:|||
  Fly   381 SEQAAEEATGEDVLNNTVQIEGKGRCLRLSYNAGKHSYVYYGQECTSRHYYICE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 35/153 (23%)
CG14866NP_001138057.1 CLECT 271..434 CDD:214480 34/162 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.