DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and MBL2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:121 Identity:29/121 - (23%)
Similarity:59/121 - (48%) Gaps:10/121 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNES 174
            :|:|:| :::...|.:.:......|.|....:|:.::..|.....|.:.  ...::.:|::..|.
Human   132 KQVGNK-FFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIK--EEAFLGITDEKTEG 193

  Fly   175 EFVSVTKGSKANFLSWADGEPT---KDGECVDIRTFNGKTTMNDNSCFANLYFICE 227
            :||.:| |::..:.:|.:|||.   .|.:|| :...||:  .||..|..:...:||
Human   194 QFVDLT-GNRLTYTNWNEGEPNNAGSDEDCV-LLLKNGQ--WNDVPCSTSHLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 26/115 (23%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113
CLECT_collectin_like 136..246 CDD:153061 27/117 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.