DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec-181

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001033456.2 Gene:clec-181 / 3896812 WormBaseID:WBGene00044511 Length:194 Species:Caenorhabditis elegans


Alignment Length:116 Identity:26/116 - (22%)
Similarity:39/116 - (33%) Gaps:23/116 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 DALDKCHK-MGGHLASLQSQEELDRFNNQL-----NGLNRYWID-----------VTNQFNESEF 176
            ||...|.| .|..|:.:|:|.|:.....|.     .|....||.           ::...|....
 Worm    72 DAEKLCQKNYGATLSGVQNQREISYVTQQALGTMSQGSGSIWIGAKRTTLCKASRLSKYCNTLTS 136

  Fly   177 VSVTKGSKANF--LSWADGEP----TKDGECVDIRTFNGKTTMNDNSCFAN 221
            ...|.||.:..  |.|.:.:|    .:..:||.:......|..:|....||
 Worm   137 FQWTDGSASGLDGLIWNNNQPDNNYNRTDQCVVLLAARTPTVSDDLQWGAN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 26/116 (22%)
clec-181NP_001033456.2 CLECT 45..170 CDD:214480 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.