DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC17A

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:146 Identity:41/146 - (28%)
Similarity:63/146 - (43%) Gaps:10/146 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NTSQQLL-THGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEEL 150
            :|:|.|: ..|....|::...|.:.....|.||.....| :|.:|...|.:...||..:.|..| 
Human   235 DTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTK-SWDEARMFCQENYSHLVIINSFAE- 297

  Fly   151 DRFNNQLNGLNR-YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTK--DGECVDIRTFNGKTT 212
            ..|..:.:|..| ||:.:.::..|.:: ....||......|...||..  |.:|.   |.|...|
Human   298 HNFVAKAHGSPRVYWLGLNDRAQEGDW-RWLDGSPVTLSFWEPEEPNNIHDEDCA---TMNKGGT 358

  Fly   213 MNDNSCFANLYFICEK 228
            .||.||:...|:|||:
Human   359 WNDLSCYKTTYWICER 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/114 (29%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
CLECT_DC-SIGN_like 254..374 CDD:153060 35/125 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.