DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and tfc

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:239 Identity:63/239 - (26%)
Similarity:90/239 - (37%) Gaps:58/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SMGNLQRRVEACEAAVAIARIALNDRRL-----------------------DNFGTSTNLQLENQ 86
            |.|..||...|  ||.:..:...|.:||                       ::|.......|::.
  Fly   136 SGGGAQRNRLA--AAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSV 198

  Fly    87 NTSQQLLTHGTAMGRKLEENEI---------------------FQQLGSKYYYIEKEEKLNWHDA 130
            .:.|....:|....|...|||:                     ..:||.|.||:....|.||..|
  Fly   199 ESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKA 263

  Fly   131 LDKCHKMGGHLASLQSQEELDRFNNQLN----GLNRYWIDVTNQFNESEFVSVTKGSKANFLSWA 191
            ...|...|.||||:.||||.||....:.    |...:||..|:..:|..|..:..|....|.:|.
  Fly   264 TQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWN 328

  Fly   192 DGEPT----KDGE---CVDIRTFNGK-TTMNDNSCFANLYFICE 227
            .|||.    ::||   |:::...:|| ...||:.|....||:||
  Fly   329 AGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 42/124 (34%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 42/124 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
33.010

Return to query results.
Submit another query.