DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec3a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102369.1 Gene:Clec3a / 365009 RGDID:1306295 Length:196 Species:Rattus norvegicus


Alignment Length:138 Identity:37/138 - (26%)
Similarity:69/138 - (50%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LEENEIFQQL---GSKYY---YIEKEEKLNWHDALDKCHKMGGHLASLQSQEEL----DRFNNQL 157
            |:|.:..|.:   |:|.:   |:..|...::|:|.:.|...||.|...::.:|:    |.....|
  Rat    58 LKEMQALQTVCLRGTKVHKKCYLASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYSKRSL 122

  Fly   158 NGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPT--KDGECVDI-RTFNGKTTMNDNSCF 219
            .|:|.:|:.:.:...|.:|:.| .|...:||:|...:|:  |...||.. ::..||  .:|.:|.
  Rat   123 PGVNDFWLGINDMVTEGKFLDV-HGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGK--WSDEACR 184

  Fly   220 ANLYFICE 227
            ::..:|||
  Rat   185 SSKRYICE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 32/122 (26%)
Clec3aNP_001102369.1 CLECT_tetranectin_like 68..193 CDD:153066 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.