DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Cd209

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102319.1 Gene:Cd209 / 363856 RGDID:1561104 Length:237 Species:Rattus norvegicus


Alignment Length:149 Identity:33/149 - (22%)
Similarity:64/149 - (42%) Gaps:29/149 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ENEIFQQL-----------------------GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQS 146
            :::|:|:|                       ||.|::.:.:.  |||:::..|.::|..|..:::
  Rat    84 QDKIYQELMQLKTEVHDGLCQPCPRDWTFFNGSCYFFSKSQR--NWHNSITACKELGAQLVIVET 146

  Fly   147 QEELDRFNNQLNGLNRYWIDVTNQFNES--EFVSVTKGSKANFLSWADGEPTKDGECVDIRTFNG 209
            .||..............|:.:::..||:  .:|..:..|.:....|..|||...|: .|...|:|
  Rat   147 DEEQTFLQQTSKTRGPTWMGLSDMHNEATWHWVDGSPLSPSFAQYWNRGEPNNVGD-EDCAEFSG 210

  Fly   210 KTTMNDNSCFANLYFICEK 228
             ...||..|...:::||:|
  Rat   211 -DGWNDLRCDTRIFWICKK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/113 (24%)
Cd209NP_001102319.1 CLECT_DC-SIGN_like 106..228 CDD:153060 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.