DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CG8343

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster


Alignment Length:117 Identity:32/117 - (27%)
Similarity:53/117 - (45%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR---------YWIDVTNQFNESEFVSV 179
            |:||..|...|...|..|.|:.|:::.....|.|....|         .|...|:..:::.:|..
  Fly    59 KVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWF 123

  Fly   180 TKGSKANFLSWADGEP---TKDGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            :||...|:.::.:|.|   :.:..|:.|...|| ..:|:| |....||:|||
  Fly   124 SKGRAVNYRNFQNGLPGYSSDNRHCLGINGING-LWVNEN-CSELRYFVCEK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/115 (26%)
CG8343NP_610207.1 CLECT 59..173 CDD:153057 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
33.010

Return to query results.
Submit another query.