DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Lectin-galC1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster


Alignment Length:152 Identity:38/152 - (25%)
Similarity:61/152 - (40%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQL 157
            :..|...| .|.:.|.|.::...||:. ..|.|||::|.:||.::...|.:.::.:|.|.....|
  Fly    28 VNEGNTFG-ALVKAEPFTKINDGYYFF-GTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFL 90

  Fly   158 --NGLN-RYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGE---CV-------DIRTFNG 209
              ||.. .||....:..........|...:.:.|.||..:|...|:   |:       |.|.|. 
  Fly    91 TANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFE- 154

  Fly   210 KTTMNDNSCFAN----LYFICE 227
               :||..|..:    ..:|||
  Fly   155 ---LNDRPCSQDPNSLFKYICE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/129 (26%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.