DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Acp29AB

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:157 Identity:48/157 - (30%)
Similarity:74/157 - (47%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QLENQNTSQQLLTHGTAMGRKLEEN---EIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLAS 143
            |:|.|....:::....|...|...|   ..|:::||::::|||.....|.:|...|.||.||||:
  Fly    84 QMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLAN 148

  Fly   144 LQSQEELDRFNNQLNGL------NRYWIDVTNQF-NESEFVSVTKGSKANFLSWADGEPT-KDGE 200
            :|.:.|||       |:      |.||||::... |...|||...|.:..|:.|...:.| |..:
  Fly   149 IQDEMELD-------GILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDTKKKNQ 206

  Fly   201 CVDIRTFNGKTTMNDNSCFANLYFICE 227
            ||.|..    ..|:.:.||....|:|:
  Fly   207 CVYIYA----KEMSYDECFEKKSFVCQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 39/120 (33%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
76.800

Return to query results.
Submit another query.