DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC4G

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_940894.1 Gene:CLEC4G / 339390 HGNCID:24591 Length:293 Species:Homo sapiens


Alignment Length:219 Identity:49/219 - (22%)
Similarity:78/219 - (35%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQL---LTHGTA---MGRK 102
            |::|.|:..|..|.:..:..:..|...|.: .|.:....:|.::..::|   :|.|.|   .||:
Human    79 AALGALKEEVGDCHSCCSGTQAQLQTTRAE-LGEAQAKLMEQESALRELRERVTQGLAEAGRGRE 142

  Fly   103 LEENEIFQQL---------------------GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQS 146
            ....|:|:.|                     ||.|::  ...|..|..|.|.|.....||..:..
Human   143 DVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFF--SVPKTTWAAAQDHCADASAHLVIVGG 205

  Fly   147 QEELDRFNNQLNGLNRYWIDV--TNQFNESEFVSVTKGSKANFLSWADGEPTKDG----ECVDIR 205
            .:|.........| ..||:.:  .....:.:......|...:|..|..||| .|.    .|| :.
Human   206 LDEQGFLTRNTRG-RGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEP-NDAWGRENCV-MM 267

  Fly   206 TFNGKTTMNDNSCFANL-YFICEK 228
            ...|  ..||..|.:.. .:||||
Human   268 LHTG--LWNDAPCDSEKDGWICEK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/118 (23%)
CLEC4GNP_940894.1 ATG16 63..>156 CDD:312208 18/77 (23%)
CLECT 165..289 CDD:321932 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.