DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and lectin-37Db

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:120 Identity:40/120 - (33%)
Similarity:65/120 - (54%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESE 175
            ::|.|.|||.. .|.||.:|.:.|.:.||.|.:|:|:|||:..:..|:....||:.:.:......
  Fly    30 EIGEKQYYISL-AKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGV 93

  Fly   176 FVSVTKGSKANFLSWADGEPTKDG---ECVDIRTFNGKTTMNDNSCFANLYFICE 227
            :||...|.:|.||:|:.|||....   .||::........|||..|::::.|||:
  Fly    94 YVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 38/115 (33%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 38/114 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4091
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.