DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and AgaP_AGAP010707

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_559213.2 Gene:AgaP_AGAP010707 / 3291143 VectorBaseID:AGAP010707 Length:114 Species:Anopheles gambiae


Alignment Length:110 Identity:26/110 - (23%)
Similarity:50/110 - (45%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 CHKMGGHLASLQSQEELDRFNNQLNGLNR-------YWIDVTNQFNESEFVSVTK----GSKANF 187
            |...||:||:.|:..:    |:::..:.|       .|:..|....:..::.:::    |..:.:
Mosquito     1 CIMNGGYLAATQTAFQ----NSEVWSVIRKAGVTGEVWVSGTQLGLQGSWIWLSRNTPVGRMSGY 61

  Fly   188 LSWADGEPT---KDGE-CVDIRTFNGKTTM-NDNSCFANLYFICE 227
            .:|..|:|:   ..|: |:.|..||  |.| ||..|.....::||
Mosquito    62 TNWYPGKPSNAANSGDNCLTIGVFN--TAMWNDRQCTREYPYVCE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 26/110 (24%)
AgaP_AGAP010707XP_559213.2 CLECT 1..105 CDD:153057 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.