DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Klra5

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038963383.1 Gene:Klra5 / 297666 RGDID:735134 Length:337 Species:Rattus norvegicus


Alignment Length:203 Identity:48/203 - (23%)
Similarity:77/203 - (37%) Gaps:52/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LQRRVEACEAAVAIARIAL-----NDRRLDNFGTSTNLQLENQ----NTSQQLLTHGTAMGRKLE 104
            :||.::..|.  .:.:|::     || .|::|..|.|......    |:||.       .|.::|
  Rat   157 MQRDIDLKEE--MLRKISIDCSPGND-LLESFNRSKNRWYSKTKAVVNSSQH-------KGSEIE 211

  Fly   105 ENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTN 169
              ..:...|.|.||:.|:.| :|.:....|......|..:..::|......||...| |||..:.
  Rat   212 --TYWFCYGIKCYYVIKDGK-SWDECKQTCQNSSLFLLKIDDEDERKFLQQQLIPDN-YWIGFSY 272

  Fly   170 QFNESEFVSVTKGSKANFLSWADGEPT-----------KDGECVDIRTFNGKTTMNDNSCFANLY 223
            ...:.|:            :|.:..|:           |.|.||    |..||.::...|. |||
  Rat   273 DKEKKEW------------AWIENGPSKLASNTMKFNKKLGGCV----FLSKTRLDHTDCI-NLY 320

  Fly   224 -FICEKSI 230
             .||.|.:
  Rat   321 SCICGKKL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/123 (24%)
Klra5XP_038963383.1 Ly49 106..223 CDD:400616 17/77 (22%)
CLECT_NK_receptors_like 211..326 CDD:153063 33/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.