DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec4a2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001005880.1 Gene:Clec4a2 / 297584 RGDID:1359163 Length:235 Species:Rattus norvegicus


Alignment Length:176 Identity:51/176 - (28%)
Similarity:75/176 - (42%) Gaps:41/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDA 130
            ||.|:.|::...:.|:.          ||...|....|::   ::..||..|:...:.|..|.::
  Rat    81 ALTDKTLNDLNCTKNVS----------LTEDKACSCCLKD---WKSFGSYCYFTSTDSKATWDES 132

  Fly   131 LDKCHKMGGHLASLQSQEELDRFNNQLN-------GLNRY------WIDVTNQFNESEFVSVTKG 182
            .:||.:||.||..:.||:|.|..|..||       ||:.:      |||.| .:||    |||  
  Rat   133 KEKCSRMGAHLLVIHSQDEQDFINTILNIGTDYFIGLSDHSENQWQWIDQT-PYNE----SVT-- 190

  Fly   183 SKANFLSWADGEP-TKDGECVDIRTFNGKTTMNDNSCFANLYFICE 227
                  .|..||| .|:.:||.| ....|...||..|......:|:
  Rat   191 ------FWHKGEPNNKEEKCVVI-NHRDKWGWNDIPCHDRHKSVCQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 40/126 (32%)
Clec4a2NP_001005880.1 CLECT_DC-SIGN_like 107..229 CDD:153060 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11467
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5325
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.