DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Pla2r1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001094307.1 Gene:Pla2r1 / 295631 RGDID:1309777 Length:1461 Species:Rattus norvegicus


Alignment Length:353 Identity:76/353 - (21%)
Similarity:122/353 - (34%) Gaps:143/353 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SIIFL--------VLP----LCLSSSYS------AACEGV-------------ESDSQCAA---- 33
            |:||.        :||    ||:|:..|      ..|:..             :.||.|.|    
  Rat   457 SVIFTNWYLLEPRILPNRRQLCVSADQSDGRWKVKGCKETLPYICKKAGQVLEDEDSGCQAGWER 521

  Fly    34 ---YCY---GVLNP---------CIASMGNLQRRVEACEAAV-----AIAR------IALNDRRL 72
               |||   .||..         |..::..:..|.|  :|.:     ::||      |||.|:  
  Rat   522 HGKYCYKIDTVLRSFEQASGGYYCPPALLTITSRFE--QAFITSLISSVARKDSYFWIALQDQ-- 582

  Fly    73 DNFGTST--------NLQLENQNTSQQ-------LLTHGTAMGR-------------------KL 103
            :|.|..|        .:|..:.|..|.       :|..|::.||                   |:
  Rat   583 NNTGEYTWKTMGQREPVQYTHWNAHQPSYHGGCVVLRGGSSFGRWEVKNCSDFKAMSLCKTPIKV 647

  Fly   104 EENEIFQ----------------QLGS--KYYYIEKE-EKLNWHDALDKCHKMGGHLASLQSQEE 149
            .|...|:                .|.|  |.::.||. .|.:|.:|...|.:.|.||||....||
  Rat   648 WEKTEFEGRWPFHPCYMDWESETGLASCFKVFHSEKVLMKRSWREAEAFCEEFGAHLASFAHIEE 712

  Fly   150 LDRFNNQLNGLNRYWIDVTNQFN---ESEF-VSVTKGSKANFLS--WADGEPTK---------DG 199
             :.|.|:|         :.::||   |.:| :...|.:..|..|  |:||.|..         :.
  Rat   713 -ENFVNKL---------LHSKFNWTQERQFWIGFNKRNPLNAGSWEWSDGSPVVSSFLDNAYFEE 767

  Fly   200 ECVDIRTFNGKTTMNDNSCFANLYFICE 227
            :..:...:....|:..::|.:...:||:
  Rat   768 DAKNCAVYKANNTLLPSNCASKHEWICK 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/128 (24%)
Pla2r1NP_001094307.1 RICIN 46..143 CDD:214672
RICIN 54..>133 CDD:238092
FN2 173..220 CDD:238019
CLECT 230..355 CDD:214480
CLECT 378..502 CDD:214480 10/44 (23%)
CLECT 515..642 CDD:214480 27/130 (21%)
CLECT 662..795 CDD:214480 33/142 (23%)
CLECT 814..936 CDD:214480
CLECT 955..1094 CDD:214480
CLECT 1118..1229 CDD:214480
CLECT 1251..1375 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.