DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Ly49i2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_690061.2 Gene:Ly49i2 / 260324 RGDID:628669 Length:280 Species:Rattus norvegicus


Alignment Length:201 Identity:38/201 - (18%)
Similarity:70/201 - (34%) Gaps:37/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQ------NTSQQLLTHGTAMGRKLEEN 106
            |.|......|..:.:....|.:..:::...:..|.|.|:      |.::.:|......|..:|.:
  Rat    83 NSQHNCSTMENDIKLKEEMLRNMSIESTRYNALLDLINREQKRWYNKTKTVLAAPQHTGGCVEMH 147

  Fly   107 EIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQF 171
            .:...:...|:.|:|.   .|...:..|.........:..::||....:.:. .:.|||.::...
  Rat   148 WLCYGIKCYYFIIDKR---TWRKCIQTCQNYSLSFLKIHDKDELKFLQDHII-RDSYWIGLSYNN 208

  Fly   172 NESEFVSVTKGSKANFLSWADGEPT-----------KDGECVDIRTFNGKTTMNDNSCFANLYFI 225
            |:.|:            ||.|....           |.|.|    .:...|.::|:.|......|
  Rat   209 NKKEW------------SWIDNTTLNCDLVAMISLHKTGNC----KYFSMTGLHDDDCGKRHLCI 257

  Fly   226 CEKSIE 231
            |||.||
  Rat   258 CEKGIE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 23/122 (19%)
Ly49i2NP_690061.2 CLECT_NK_receptors_like 145..260 CDD:153063 24/134 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.