DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7763 and Bcan

DIOPT Version :9

Sequence 1:	NP_001356891.1	Gene:	CG7763 / 36235	FlyBaseID:	FBgn0040503	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	XP_038957712.1	Gene:	Bcan / 25393	RGDID:	2194	Length:	890	Species:	Rattus norvegicus

Alignment Length:	131	Identity:	31/131 - (23%)
Similarity:	60/131 - (45%)	Gaps:	18/131 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   107 EIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRY----WIDV 167
            |.||....|::    ..:.:|.:|..:|..:|.||.|:.:.||.|..|      :||    ||.:
  Rat   669 EAFQGACYKHF----STRRSWEEAESQCRALGAHLTSICTPEEQDFVN------DRYREYQWIGL 723

  Fly   168 TNQFNESEFVSVTKGSKANFLSWADGEPTK---DGECVDIRTFNGKTTMNDNSCFANLYFICEKS 229
            .::..|.:|: .:.|:...:.:|..|:|..   .||...:..::.:...:|..|..:|.:.|:..
  Rat   724 NDRTIEGDFL-WSDGAPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMG 787

  Fly   230 I 230
            :
  Rat   788 L 788

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7763	NP_001356891.1	CLECT	116..228	CDD:153057	27/118 (23%)
Bcan	XP_038957712.1	Ig	40..158	CDD:416386
		Ig strand A'	44..46	CDD:409353
		Ig strand B	50..58	CDD:409353
		Ig strand C	75..81	CDD:409353
		Ig strand C'	86..89	CDD:409353
		Ig strand D	107..112	CDD:409353
		Ig strand E	118..124	CDD:409353
		Ig strand F	132..139	CDD:409353
		Ig strand G	149..158	CDD:409353
		Link_domain_CSPGs_modules_1_3	156..250	CDD:239594
		Link_domain_CSPGs_modules_2_4	257..352	CDD:239597
		fibronec_FbpA	<369..629	CDD:411474
		EGF	626..655	CDD:394967
		CLECT	664..787	CDD:413318	31/128 (24%)
		CCP	791..848	CDD:153056
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910