DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Klrb1b

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_775414.2 Gene:Klrb1b / 25192 RGDID:2975 Length:223 Species:Rattus norvegicus


Alignment Length:148 Identity:32/148 - (21%)
Similarity:64/148 - (43%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFN 154
            |:..|..|....||:..:.:.....|.::: .:..:.|..:|..|...|..|..:|.||||....
  Rat    79 QENRTKTTDSPAKLKCPKDWHSHQDKCFHV-SQTSITWKGSLADCGGKGATLLLVQDQEELRFLR 142

  Fly   155 NQLNGL-NRYWIDVTNQFNESEFVSVTKGSKANFLSWAD-----GEPTKDGECVDIRTFNGKTTM 213
            |....: :.:||.::...::.::..: .||..|    :|     |:..|| .|..:    .:..:
  Rat   143 NLTKRISSSFWIGLSYTLSDEKWKWI-NGSTLN----SDALNITGDTEKD-SCASV----SQDKV 197

  Fly   214 NDNSCFANLYFICEKSIE 231
            ...||.::..:||:|.::
  Rat   198 LSESCDSDNIWICQKELK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 25/117 (21%)
Klrb1bNP_775414.2 ITIM motif 5..10
LCK-binding motif. /evidence=ECO:0000250|UniProtKB:P27812 31..34
CLECT_NK_receptors_like 94..212 CDD:153063 26/128 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.