DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7763 and Pkd1

DIOPT Version :9

Sequence 1:	NP_001356891.1	Gene:	CG7763 / 36235	FlyBaseID:	FBgn0040503	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_001244281.1	Gene:	Pkd1 / 24650	RGDID:	3333	Length:	4292	Species:	Rattus norvegicus

Alignment Length:	144	Identity:	30/144 - (20%)
Similarity:	51/144 - (35%)	Gaps:	43/144 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   105 ENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRF--NNQLNGLNRYWIDV 167
            :.|||.  |:.:.|....||..|..|.::|....|...::.....:..|  :.....|: .||..
  Rat   409 DTEIFP--GNGHCYRLVAEKAPWLQAQEQCRTWAGAALAMVDSPAIQHFLVSKVTRSLD-VWIGF 470

  Fly   168 TNQFNESEFVSVTKG--------SKANFLSWADGEP---TKD--------GECVDIRTFNGKTTM 213
            ::       |...:|        |..:..:|..|||   |::        |:|
  Rat   471 SS-------VEGKEGLDPQGEAFSLESCQNWLPGEPHPATEEHCVRLGPAGQC------------ 516

  Fly   214 NDNSCFANLYFICE 227
            |.:.|.|...::||
  Rat   517 NTDLCSAPHSYVCE 530

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7763	NP_001356891.1	CLECT	116..228	CDD:153057	26/133 (20%)
Pkd1	NP_001244281.1	LRRNT	32..71	CDD:214470
		LRR_8	61..127	CDD:290566
		leucine-rich repeat	70..92	CDD:275378
		LRR_4	72..108	CDD:289563
		leucine-rich repeat	93..116	CDD:275378
		PCC	97..2722	CDD:188093	30/144 (21%)
		leucine-rich repeat	117..129	CDD:275378
		LRRCT	125..177	CDD:214507
		WSC	177..271	CDD:214616
		PKD	277..344	CDD:279180
		CLECT	406..530	CDD:214480	28/142 (20%)
		PKD	927..1007	CDD:214510
		PKD	1017..1115	CDD:214510
		PKD	1124..1195	CDD:279180
		PKD	1214..1278	CDD:279180
		PKD	1289..1370	CDD:214510
		PKD	1378..1449	CDD:279180
		PKD	1471..1538	CDD:214510
		PKD	1546..1615	CDD:279180
		PKD	1635..1703	CDD:279180
		PKD	1718..1787	CDD:279180
		PKD	1807..1871	CDD:279180
		PKD	1886..1955	CDD:279180
		PKD	1974..2045	CDD:279180
		PKD	2062..2129	CDD:279180
		GPS	3002..3051	CDD:197639
		PLAT_polycystin	3109..3228	CDD:238850
		PKD_channel	3700..4102	CDD:285288
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910