DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and FCER2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001207429.1 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:151 Identity:46/151 - (30%)
Similarity:64/151 - (42%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLAS 143
            |.|::|.|.:|      |.......|:...||:   |.||..|..| .|..|...|..|.|.|.|
Human   146 TKLRMELQVSS------GFVCNTCPEKWINFQR---KCYYFGKGTK-QWVHARYACDDMEGQLVS 200

  Fly   144 LQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRTFN 208
            :.|.||.|......:.... ||.:.|...:.||:.| .||..::.:||.||||...:..|.....
Human   201 IHSPEEQDFLTKHASHTGS-WIGLRNLDLKGEFIWV-DGSHVDYSNWAPGEPTSRSQGEDCVMMR 263

  Fly   209 GKTTMNDNSCFANL-YFICEK 228
            |....||..|...| .::|::
Human   264 GSGRWNDAFCDRKLGAWVCDR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/112 (32%)
FCER2NP_001207429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85
Repetitive region 69..89
RILP-like <77..153 CDD:304877 3/6 (50%)
Repetitive region 90..110
Repetitive region 111..131
CLECT 163..282 CDD:214480 39/124 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.