DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec3b

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_035736.2 Gene:Clec3b / 21922 MGIID:104540 Length:202 Species:Mus musculus


Alignment Length:173 Identity:37/173 - (21%)
Similarity:66/173 - (38%) Gaps:50/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RKLEENEIFQQLGSKYYYIEKE-----------------EKLN------------WHDALDKCHK 136
            :.|..:::|::|.::...:.:|                 .|:|            :|:|.:.|..
Mouse    36 KDLVSSKMFEELKNRMDVLAQEVALLKEKQALQTVCLKGTKVNLKCLLAFTQPKTFHEASEDCIS 100

  Fly   137 MGGHLASLQSQEELDRF--------NNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADG 193
            .||.|.:.||:.|.:..        .|..|    .|:.:.:...|..:|.:|.|..| :.:|...
Mouse   101 QGGTLGTPQSELENEALFEYARHSVGNDAN----IWLGLNDMAAEGAWVDMTGGLLA-YKNWETE 160

  Fly   194 EPTK-DG----ECVDIR-TFNGKTTMNDNSCFANLYFICEKSI 230
            ..|: ||    .|..:. ..|||  ..|..|...|.:||:.:|
Mouse   161 ITTQPDGGKAENCAALSGAANGK--WFDKRCRDQLPYICQFAI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/154 (21%)
Clec3bNP_035736.2 CLECT_tetranectin_like 71..199 CDD:153066 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.