DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Sele

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_035475.1 Gene:Sele / 20339 MGIID:98278 Length:619 Species:Mus musculus


Alignment Length:117 Identity:31/117 - (26%)
Similarity:54/117 - (46%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQL-NGLNRYWIDVTNQFNESEFVSV 179
            :||....|.:.:.:|...|.:...||.::|::||::..|:.| :..:.|||.:....|...:|..
Mouse    29 WYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSNLKHSPSYYWIGIRKVNNVWIWVGT 93

  Fly   180 TKGSKANFLSWADGEPT---KDGECVDIRTFNGKTT--MNDNSCFANLYFIC 226
            .|.......:||.|||.   ::.:||:|.....|.:  .||..|......:|
Mouse    94 GKPLTEEAQNWAPGEPNNKQRNEDCVEIYIQRTKDSGMWNDERCNKKKLALC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/117 (26%)
SeleNP_035475.1 CLECT_selectins_like 29..147 CDD:153062 31/117 (26%)
EGF_CA <155..182 CDD:238011
CCP 187..245 CDD:153056
PHA02927 269..496 CDD:222943
CCP 501..556 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.