DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Reg2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_033069.1 Gene:Reg2 / 19693 MGIID:97896 Length:173 Species:Mus musculus


Alignment Length:134 Identity:39/134 - (29%)
Similarity:53/134 - (39%) Gaps:33/134 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSKYYYIEKEEKLNWHDALDKCHKM-GGHLASLQSQEELD-----------RFNNQLNGL----- 160
            ||..||: .|::|.|.:|...|..| .|||.|:.||.|.:           ..:|...||     
Mouse    51 GSYCYYL-IEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKS 114

  Fly   161 NRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPT--KDGECVDIRTFNGKTTMNDNSCFANLY 223
            ||.|             ..:.||...|.|||.|.|:  ..|.||.:.:........|.:|.|...
Mouse   115 NRRW-------------HWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYS 166

  Fly   224 FICE 227
            |:|:
Mouse   167 FVCK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 37/131 (28%)
Reg2NP_033069.1 CLECT 43..171 CDD:295302 39/134 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.