DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec-118

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_493771.3 Gene:clec-118 / 189207 WormBaseID:WBGene00021032 Length:193 Species:Caenorhabditis elegans


Alignment Length:79 Identity:19/79 - (24%)
Similarity:35/79 - (44%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR--YWIDVTNQFN--ESEFVSVTKGSKAN 186
            |.::|..:|...|..|:.:|::.||:...:|...|..  :|:....:.:  .|:..:..  :..|
 Worm    70 NRNEASARCATEGAVLSGVQNKAELNAMISQFTRLGNGYFWVGAMRKTSCLMSQLTATC--TALN 132

  Fly   187 FLSWADGEPT-KDG 199
            ...|.||..| .||
 Worm   133 SFEWTDGSTTGTDG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 19/79 (24%)
clec-118NP_493771.3 CLECT 57..191 CDD:153057 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.