DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec-26

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_507254.2 Gene:clec-26 / 188626 WormBaseID:WBGene00011852 Length:367 Species:Caenorhabditis elegans


Alignment Length:316 Identity:63/316 - (19%)
Similarity:99/316 - (31%) Gaps:124/316 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPLCLSSS---YSAACEGVESDS--------QCAAYCYGVLNPCIASMGNLQRRVEACEAAVAIA 63
            ||:...||   :|.:...:.|.|        .|||....:.:.|...:...|.|.:|        
 Worm    78 LPITTKSSTTHWSTSSTPISSTSPTSAPENYSCAAGFPYINHKCWKLVTGPQNRADA-------- 134

  Fly    64 RIALNDRRLDNFGTSTNLQLENQNTSQQLL----------------------------------- 93
                 |:..:|.|.||...:.|...:|.:|                                   
 Worm   135 -----DQACNNLGGSTLFSIRNDQDNQAVLEFVKDQQVKNLWTGLICDNNDPSLCTWDVQSGTTA 194

  Fly    94 ---------------------THGTAMGRKLEE--NEIFQ---QLGSKYYYIEKEEKLNWH---- 128
                                 |.||..|:....  ||...   :|.:..|  ::..|.|::    
 Worm   195 AYNNFAKGYPSGVNEECIYYMTTGTQAGQWASGLCNETMSFVCELPTTIY--DETCKYNYNTYCY 257

  Fly   129 ----------DALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGS 183
                      ||...|..:|.:|.|:.|..|           |||.:.:....|::..:.....|
 Worm   258 TPYSLGKTASDAQSYCTSLGSNLVSIHSGNE-----------NRYVMTINFGRNKNILIGGVAFS 311

  Fly   184 KANFLSWADGEPT--------KDGECVDIRTFNGKTTMNDNSCFA-NLYFICEKSI 230
            . :.:.|.||..:        |||.|:::...||.....|  |.| |.||||::.|
 Worm   312 N-DVMLWYDGTESNFNNIYQIKDGNCLNMNNTNGGWYGGD--CMASNNYFICKRRI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/134 (25%)
clec-26NP_507254.2 CLECT 110..238 CDD:214480 21/140 (15%)
CLECT 252..361 CDD:214480 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.