DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and F52E1.2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_505170.2 Gene:F52E1.2 / 186111 WormBaseID:WBGene00018692 Length:204 Species:Caenorhabditis elegans


Alignment Length:144 Identity:32/144 - (22%)
Similarity:57/144 - (39%) Gaps:37/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRF------NNQLNGLNRYWIDV 167
            :|.|.||.|. :.:..:.:..|...|...|..|.::.|.:|.|..      |..::.....||.:
 Worm    70 WQYLNSKCYK-KFDAAVTYAGATSACAAQGAELVTIDSFDENDALRKAFDTNALVDETKETWIGL 133

  Fly   168 TNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDI-----------------RTFN-GKTTMN 214
            .:.....::..   ||.|.:.:||..:|:.:|.||.:                 :|:. |||:.:
 Worm   134 KSLSGAWQWAD---GSSATYTNWAPSQPSSNGLCVQMITDSLSNATYKYQRGGWKTYGCGKTSAS 195

  Fly   215 DNSCFANLYFICEK 228
                     :||||
 Worm   196 ---------YICEK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 26/135 (19%)
F52E1.2NP_505170.2 CLECT 66..199 CDD:214480 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4091
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.