DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec-49

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_507829.1 Gene:clec-49 / 180298 WormBaseID:WBGene00012251 Length:321 Species:Caenorhabditis elegans


Alignment Length:138 Identity:34/138 - (24%)
Similarity:57/138 - (41%) Gaps:11/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GTAMGRKLEENEIF-QQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQS-QEELDRFNNQLN 158
            |.|..:......|: :|....|.|.....:.::  |..:|:.:||||||:|: ||.....:|..|
 Worm    13 GAATAQTCNTGGIYNEQFNRCYQYFTAPAQFSF--AEQQCNLLGGHLASVQNGQENALLQSNAAN 75

  Fly   159 GLNR-----YWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRTFNGKTTMNDNSC 218
            ...|     |||..|:......:.........::.:|..|||....:|. |:. .|..|.:...|
 Worm    76 SFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSGSDCA-IQD-KGDGTWSAIGC 138

  Fly   219 FANLYFIC 226
            .:...::|
 Worm   139 TSYRPYVC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/117 (26%)
clec-49NP_507829.1 CLECT 31..146 CDD:214480 29/118 (25%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.