DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec-204

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_503499.2 Gene:clec-204 / 178656 WormBaseID:WBGene00021603 Length:551 Species:Caenorhabditis elegans


Alignment Length:143 Identity:38/143 - (26%)
Similarity:57/143 - (39%) Gaps:37/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKC---HKMGGH---LASLQSQEELDRFNNQLN--------- 158
            |:.|.:...|....||..:.||.:.|   |.:..|   |.|::::.|.|:....::         
 Worm   410 FESLHNAKCYRVSSEKKQFVDAENLCLSKHPLFLHTPKLTSIETKIEEDQVRTLIHTQPLVNEGM 474

  Fly   159 ---GLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEP-TKDG-ECVDIRTFNGKTTMNDNS- 217
               ||.|   |.:|..|.......|..|  ::.:|..|.| ..|| :||.:       .:|||| 
 Worm   475 FWFGLKR---DPSNSSNWYFINGDTYDS--SYQNWRSGYPRDADGCDCVAL-------VINDNSW 527

  Fly   218 ----CFANLYFIC 226
                |...||.||
 Worm   528 VNTDCNKQLYSIC 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/136 (26%)
clec-204NP_503499.2 CLECT <68..>116 CDD:295302
CLECT 414..540 CDD:214480 34/137 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.