DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7763 and ACAN

DIOPT Version :9

Sequence 1:	NP_001356891.1	Gene:	CG7763 / 36235	FlyBaseID:	FBgn0040503	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_001356197.1	Gene:	ACAN / 176	HGNCID:	319	Length:	2568	Species:	Homo sapiens

Alignment Length:	130	Identity:	34/130 - (26%)
Similarity:	60/130 - (46%)	Gaps:	9/130 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   105 ENEIFQQLGSKYY---YIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWID 166
            :.|:.::..:||.   |....::..|.||..:|.:...||:|:.:.||.:..||  |..:..||.
Human  2354 DQEVCEEGWNKYQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNN--NAQDYQWIG 2416

  Fly   167 VTNQFNESEFVSVTKGSKANFLSWADGEPTK---DGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            :.::..|.:| ..:.|....|.:|...:|..   .||...:..::.|...||..|..:|.|.|:|
Human  2417 LNDRTIEGDF-RWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKK 2480

Fly 229 228
Human 2481 2480

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7763	NP_001356891.1	CLECT	116..228	CDD:153057	31/117 (26%)
ACAN	NP_001356197.1	Ig_Aggrecan	43..154	CDD:143308
		G1-A	48..141
		G1-B	152..247
		Link_domain_CSPGs_modules_1_3	153..247	CDD:239594
		G1-B'	253..349
		Link_domain_CSPGs_modules_2_4	254..349	CDD:239597
		G2-B	477..571
		Link_domain_CSPGs_modules_1_3	478..572	CDD:239594
		G2-B'	578..673
		Link_domain_CSPGs_modules_2_4	579..674	CDD:239597
		KS	677..849
		PHA03307	716..>975	CDD:223039
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	734..979
		12 X 6 AA approximate tandem repeats of E-[GVE]-P-[SFY]-[APT]-[TSP]	773..844
		CS-1	852..1612
		35 X 19 AA approximate tandem repeats of E-[IVDG]-[LV]-[EV]-[GTI]-[STA]-[ATV]-[SP]-[GA]-[VIFAD]- [GEDL]-[DE]-[LVI]-[SG]-[GERK]-[LV]-P-S-G	942..1612
		PRK15387	<1433..>1614	CDD:185285
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1499..1526
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1543..1649
		CS-2	1613..2277
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1687..1772
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1784..1827
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1883..1902
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1948..1977
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2048..2204
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2249..2281
		EGF_CA	2283..2313	CDD:238011
		EGF_CA	2316..2352	CDD:238011
		CLECT_CSPGs	2358..2481	CDD:153058	33/126 (26%)
		CCP	2485..2541	CDD:153056
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2548..2568
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910