DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Mrc2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006532469.1 Gene:Mrc2 / 17534 MGIID:107818 Length:1513 Species:Mus musculus


Alignment Length:129 Identity:39/129 - (30%)
Similarity:57/129 - (44%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLN-----RYWIDVT 168
            ||:...|::    |...:|..|...|......|.|:.||.|||.....|..|:     .:||.:.
Mouse   866 FQEAEYKFF----EHHSSWAQAQRICTWFQADLTSVHSQAELDFLGQNLQKLSSDQEQHWWIGLH 926

  Fly   169 NQFNESEFVSVTKGSKANFLSWADGEPT---KDGECVDIRTFNGKTTMNDNSCFANLYFICEKS 229
            ...::..| ..|.||..||:|||.|:|.   ||.:||.:..  .:....|..|...|.:||::|
Mouse   927 TLESDGRF-RWTDGSIINFISWAPGKPRPIGKDKKCVYMTA--RQEDWGDQRCHTALPYICKRS 987

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 35/119 (29%)
Mrc2XP_006532469.1 CLECT 1165..1277 CDD:214480
CLECT 1294..1427 CDD:214480
RICIN 80..195 CDD:214672
FN2 214..262 CDD:128373
CLECT 281..395 CDD:153057
CLECT 416..539 CDD:214480
CLECT 555..678 CDD:214480
CLECT 703..843 CDD:214480
CLECT 863..985 CDD:214480 37/125 (30%)
CLECT 1006..1142 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.