DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Mrc1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_032651.2 Gene:Mrc1 / 17533 MGIID:97142 Length:1456 Species:Mus musculus


Alignment Length:238 Identity:65/238 - (27%)
Similarity:98/238 - (41%) Gaps:51/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LSSSYSAACEGVE-SDSQCAAY---CYGVLNPCIASMGNLQRRVEACEAAVAIARIALND---RR 71
            |..:|.:..||.. ||....:|   .||..|       |.| .||.|........::.||   ..
Mouse   715 LGLTYGSPSEGFTWSDGSPVSYENWAYGEPN-------NYQ-NVEYCGELKGDPGMSWNDINCEH 771

  Fly    72 LDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLG----SKYYYIEKEEKLNWHDALD 132
            |:|:    ..|::...|   ||...|...   ::|......|    ..|.|...:||....:|..
Mouse   772 LNNW----ICQIQKGKT---LLPEPTPAP---QDNPPVTADGWVIYKDYQYYFSKEKETMDNARA 826

  Fly   133 KCHKMGGHLASLQSQEE---LDRFNNQLNGLNRYWIDVTNQFNESEFVSVTK------GSKANFL 188
            .|.|..|.||:::|:.|   |.::.|:..|.:.|:|.:        .:|:.|      |||.:|:
Mouse   827 FCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGM--------LISMDKKFIWMDGSKVDFV 883

  Fly   189 SWADGEP---TKDGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            :||.|||   ..|..||.:.|.:|  ..||.:|.....|||::
Mouse   884 AWATGEPNFANDDENCVTMYTNSG--FWNDINCGYPNNFICQR 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 39/123 (32%)
Mrc1NP_032651.2 RICIN 27..142 CDD:214672
RICIN 34..140 CDD:238092
FN2 161..209 CDD:128373
CLECT 234..342 CDD:153057
CLECT 362..487 CDD:214480
CLECT 504..626 CDD:214480
CLECT 659..779 CDD:153057 19/75 (25%)
CLECT 802..923 CDD:214480 39/130 (30%)
CLECT 944..1079 CDD:214480
CLECT 1096..1212 CDD:214480
CLECT 1229..1355 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.