DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec-150

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_497312.1 Gene:clec-150 / 175261 WormBaseID:WBGene00019914 Length:362 Species:Caenorhabditis elegans


Alignment Length:121 Identity:32/121 - (26%)
Similarity:50/121 - (41%) Gaps:18/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KYYYIEKEEKLNWHDALDKCHKMGG-HLASLQSQEELDRFNNQLNGL--------NRYWIDVTNQ 170
            |:.|:......::|||...|:..|| ||||:.|..:    ||.|..|        |.:||.:|:.
 Worm    36 KFCYVVHTGAASFHDAEKACYDYGGYHLASVPSMID----NNFLYNLSSNSNVWANYFWIGLTDM 96

  Fly   171 FNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRTFNGKTTMNDNSCFANLYFIC 226
            ..:..:..: .|....|::||.....  |.|..:|..:.:....|  |.....|.|
 Worm    97 TADGSWEWI-DGLDLVFMNWASSSTA--GYCGAMRAADARWQAQD--CTKPYPFFC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/120 (26%)
clec-150NP_497312.1 CLECT 33..147 CDD:214480 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.