DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec10a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001191181.1 Gene:Clec10a / 17312 MGIID:96975 Length:305 Species:Mus musculus


Alignment Length:227 Identity:55/227 - (24%)
Similarity:86/227 - (37%) Gaps:47/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ASMGNLQRRVEACEAAVAIARIALNDRR--------LDNFGTSTNLQLENQNTS----------- 89
            |...:|..|.::.|..::..::.:.|.|        |....||....:|.:..:           
Mouse    82 AEFQSLDSRADSFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTVEKREQALKTDLSDLTDH 146

  Fly    90 -QQL---LTHGTAMGRKLEEN--EI-------FQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHL 141
             |||   |...|.....|:.|  |:       .:..||.|::.|.|:  :|.:|...|.....||
Mouse   147 VQQLRKDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEK--SWPEADKYCRLENSHL 209

  Fly   142 ASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTK-------DG 199
            ..:.|.||.:...|:|..:.. ||.:|:|.....:|..|...| .|.:||..:|..       .|
Mouse   210 VVVNSLEEQNFLQNRLANVVS-WIGLTDQNGPWRWVDGTDFEK-GFKNWAPLQPDNWFGHGLGGG 272

  Fly   200 E-CVDIRTFNGKTTMNDNSCFANLYFICEKSI 230
            | |..|.|..   ..||:.|.....:|||..:
Mouse   273 EDCAHITTGG---PWNDDVCQRTFRWICEMKL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/119 (29%)
Clec10aNP_001191181.1 Lectin_N 14..164 CDD:281887 15/81 (19%)
CLECT_DC-SIGN_like 174..299 CDD:153060 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.