DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Mbl1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_034905.1 Gene:Mbl1 / 17194 MGIID:96923 Length:239 Species:Mus musculus


Alignment Length:274 Identity:59/274 - (21%)
Similarity:99/274 - (36%) Gaps:93/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLP-----LC---LSSSYSAACEGVESDSQCAAYCY--------------------------GV 38
            |:||     ||   :|||.|..||  ::...|:....                          |.
Mouse     2 LLLPLLPVLLCVVSVSSSGSQTCE--DTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGK 64

  Fly    39 LNP--CIASMGN---------------LQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQ 86
            |.|  .:.|.|:               ::.::...||.:.|.:              :.|||.|:
Mouse    65 LGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILK--------------SKLQLTNK 115

  Fly    87 NTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELD 151
                   .|..:||:|          ..|..::...||:.:......|.::.|.:|..::.||..
Mouse   116 -------LHAFSMGKK----------SGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENK 163

  Fly   152 RFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG---ECVDIRTFNGKTTM 213
            .......|:  .::.:|::..|.:|:.|| |.:..:.:|...||...|   :||.|.. ||  ..
Mouse   164 AIQEVATGI--AFLGITDEATEGQFMYVT-GGRLTYSNWKKDEPNNHGSGEDCVIILD-NG--LW 222

  Fly   214 NDNSCFANLYFICE 227
            ||.||.|:...:||
Mouse   223 NDISCQASFKAVCE 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/115 (26%)
Mbl1NP_034905.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..88 5/52 (10%)
Collagen <37..89 CDD:189968 5/51 (10%)
CLECT_collectin_like 127..237 CDD:153061 31/116 (27%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000250|UniProtKB:P19999 203..211 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.