DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Fcer2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:196 Identity:54/196 - (27%)
Similarity:78/196 - (39%) Gaps:37/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LNDRRLDNFGT-STNLQL-ENQNTSQQLLTHGTAMG-----------RKLEEN------EIFQQL 112
            ||:.:.|.... |.|.:| :|.||.|:.|.:..:.|           .||:|.      ||....
  Rat   115 LNELQEDLINVKSQNSELSQNLNTLQEDLVNVKSQGLNEKRAASDSLEKLQEEVAKLWIEILMSK 179

  Fly   113 GS--------------KYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRY 163
            |:              |.||..:..| .|..|...|..:.|.|.|:.||:|.|.....:| ....
  Rat   180 GTACNVCPKDWLHFQQKCYYFGEGSK-QWIQAKFTCSDLEGRLVSIHSQKEQDFLMQHIN-KKES 242

  Fly   164 WIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRTFNGKTTMNDNSCFANL-YFICE 227
            ||.:.:...|.||| ...||...:.:|:.|||...|:..|.....|....||..|.:.| .::||
  Rat   243 WIGLQDLNMEGEFV-WPDGSPVGYSNWSPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCE 306

  Fly   228 K 228
            :
  Rat   307 Q 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/112 (30%)
Fcer2NP_001029096.1 RILP-like <60..170 CDD:304877 15/54 (28%)
CLECT_DC-SIGN_like 186..306 CDD:153060 34/122 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.